SCOPe 2.06: Domain d2v9sa_: 2v9s A:

Lineage for d2v9sa_ (2v9s A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (12 PDB entries)

8. Domain d2v9sa_: 2v9s A: [168408]
   automated match to d1w8aa_
   complexed with gol, peg

Details for d2v9sa_

PDB Entry: 2v9s, 2 Å

PDB Description: Second LRR domain of human Slit2

PDB Compounds: (A:) slit homolog 2 protein n-product

SCOPe Domain Sequences for d2v9sa_:

Sequence; same for both SEQRES and ATOM records:

>d2v9sa_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
tsgarctsprrlankrigqikskkfrc

Timeline for d2v9sa_:

• d2v9sa_ first appeared in SCOPe 2.01
  
• d2v9sa_ appears in SCOPe 2.05
  
• d2v9sa_ appears in SCOPe 2.07
  
• d2v9sa_ appears in the current release, SCOPe 2.08