Lineage for d2v8ca_ (2v8c A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970082Protein automated matches [190412] (11 species)
    not a true protein
  7. 2970109Species Mouse (Mus musculus) [TaxId:10090] [188306] (1 PDB entry)
  8. 2970110Domain d2v8ca_: 2v8c A: [168376]
    automated match to d1d1ja_
    complexed with gol, ipa, na, so4

Details for d2v8ca_

PDB Entry: 2v8c (more details), 1.98 Å

PDB Description: mouse profilin iia in complex with the proline-rich domain of vasp
PDB Compounds: (A:) profilin-2

SCOPe Domain Sequences for d2v8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v8ca_ d.110.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpveidmivgkdregfft
ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragrvlvfvmgkegvhg
gglnkkaysmakylrdsgf

SCOPe Domain Coordinates for d2v8ca_:

Click to download the PDB-style file with coordinates for d2v8ca_.
(The format of our PDB-style files is described here.)

Timeline for d2v8ca_: