SCOPe 2.05: Domain d2v76d_: 2v76 D:

Lineage for d2v76d_ (2v76 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein automated matches [190580] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188312] (3 PDB entries)

8. Domain d2v76d_: 2v76 D: [168366]
   automated match to d1p5ta_
   complexed with edo, gol, pge, so4

Details for d2v76d_

PDB Entry: 2v76, 1.6 Å

PDB Description: crystal structure of the human dok1 ptb domain

PDB Compounds: (D:) Docking protein 1

SCOPe Domain Sequences for d2v76d_:

Sequence; same for both SEQRES and ATOM records:

>d2v76d_ b.55.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrrygrd
kvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihr

Timeline for d2v76d_:

• d2v76d_ first appeared in SCOPe 2.01
  
• d2v76d_ appears in SCOPe 2.04
  
• d2v76d_ appears in SCOPe 2.06
  
• d2v76d_ appears in the current release, SCOPe 2.08