SCOPe 2.02: Domain d2v5hk_: 2v5h K:

Lineage for d2v5hk_ (2v5h K:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (7 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (2 PDB entries)

8. Domain d2v5hk_: 2v5h K: [168351]
   automated match to d1qy7a_
   complexed with cl, gol, na, nlg

Details for d2v5hk_

PDB Entry: 2v5h, 2.75 Å

PDB Description: Controlling the storage of nitrogen as arginine: the complex of PII and acetylglutamate kinase from Synechococcus elongatus PCC 7942

PDB Compounds: (K:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2v5hk_:

Sequence; same for both SEQRES and ATOM records:

>d2v5hk_ d.58.5.1 (K:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn

Timeline for d2v5hk_:

• d2v5hk_ first appeared in SCOPe 2.01
  
• d2v5hk_ appears in SCOPe 2.03
  
• d2v5hk_ appears in the current release, SCOPe 2.08