Lineage for d2v4va_ (2v4v A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305647Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1305648Protein automated matches [190770] (10 species)
    not a true protein
  7. 1305649Species Clostridium cellulolyticum [TaxId:1521] [189080] (1 PDB entry)
  8. 1305650Domain d2v4va_: 2v4v A: [168340]
    automated match to d1gmma_
    complexed with na, xyp

Details for d2v4va_

PDB Entry: 2v4v (more details), 1.5 Å

PDB Description: crystal structure of a family 6 carbohydrate-binding module from clostridium cellulolyticum in complex with xylose
PDB Compounds: (A:) gh59 galactosidase

SCOPe Domain Sequences for d2v4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4va_ b.18.1.0 (A:) automated matches {Clostridium cellulolyticum [TaxId: 1521]}
qsaysrieaesysnqsgiqtetcseggedvgfvengdytvynnvdfgdgvggfqarvasa
tsggnieirldsstgtligtcpvagtgdwqtytdakctvsgvtgkhdvylvfkgdsgylf
nlnwftfse

SCOPe Domain Coordinates for d2v4va_:

Click to download the PDB-style file with coordinates for d2v4va_.
(The format of our PDB-style files is described here.)

Timeline for d2v4va_: