Lineage for d2v2ra_ (2v2r A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990632Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)
  8. 1990637Domain d2v2ra_: 2v2r A: [168317]
    automated match to d1data_
    complexed with cd, gol, so4; mutant

Details for d2v2ra_

PDB Entry: 2v2r (more details), 1.9 Å

PDB Description: mutant (e53,56,57,60q and r59m) recombinant horse spleen apoferritin cocrystallized with haemin in basic conditions
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2ra_ a.25.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkmqg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

SCOPe Domain Coordinates for d2v2ra_:

Click to download the PDB-style file with coordinates for d2v2ra_.
(The format of our PDB-style files is described here.)

Timeline for d2v2ra_: