SCOPe 2.06: Domain d2v2pa_: 2v2p A:

Lineage for d2v2pa_ (2v2p A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)

8. Domain d2v2pa_: 2v2p A: [168316]
   automated match to d1data_
   complexed with cd, gol, so4; mutant

Details for d2v2pa_

PDB Entry: 2v2p, 1.15 Å

PDB Description: mutant (e53,56,57,60q and r59m) recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions

PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2pa_:

Sequence; same for both SEQRES and ATOM records:

>d2v2pa_ a.25.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkmqg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

Timeline for d2v2pa_:

• d2v2pa_ first appeared in SCOPe 2.01
  
• d2v2pa_ appears in SCOPe 2.05
  
• d2v2pa_ appears in SCOPe 2.07
  
• d2v2pa_ appears in the current release, SCOPe 2.08