Lineage for d2v2oa_ (2v2o A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 910728Protein (Apo)ferritin [47246] (8 species)
  7. 910764Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (44 PDB entries)
  8. 910794Domain d2v2oa_: 2v2o A: [168315]
    automated match to d1data_
    complexed with cd, gol, so4; mutant

Details for d2v2oa_

PDB Entry: 2v2o (more details), 1.87 Å

PDB Description: mutant r59m recombinant horse spleen apoferritin cocrystallized with haemin in basic conditions
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2oa_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekme
gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOPe Domain Coordinates for d2v2oa_:

Click to download the PDB-style file with coordinates for d2v2oa_.
(The format of our PDB-style files is described here.)

Timeline for d2v2oa_: