SCOPe 2.02: Domain d2v08b_: 2v08 B:

Lineage for d2v08b_ (2v08 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (12 species)
   not a true protein

7. Species Phormidium laminosum [TaxId:32059] [187369] (2 PDB entries)

8. Domain d2v08b_: 2v08 B: [168272]
   automated match to d1c6sa_
   complexed with cl, hem, imd, zn

Details for d2v08b_

PDB Entry: 2v08, 2 Å

PDB Description: structure of wild-type phormidium laminosum cytochrome c6

PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d2v08b_:

Sequence; same for both SEQRES and ATOM records:

>d2v08b_ a.3.1.1 (B:) automated matches {Phormidium laminosum [TaxId: 32059]}
dlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmpaf
kgrltddqiaavaayvldqaekgw

Timeline for d2v08b_:

• d2v08b_ first appeared in SCOPe 2.01
  
• d2v08b_ appears in SCOPe 2.03
  
• d2v08b_ appears in the current release, SCOPe 2.08