Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein automated matches [190113] (17 species) not a true protein |
Species Phormidium laminosum [TaxId:32059] [187369] (2 PDB entries) |
Domain d2v08b_: 2v08 B: [168272] automated match to d1c6sa_ complexed with cl, hec, imd, zn |
PDB Entry: 2v08 (more details), 2 Å
SCOPe Domain Sequences for d2v08b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v08b_ a.3.1.1 (B:) automated matches {Phormidium laminosum [TaxId: 32059]} dlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmpaf kgrltddqiaavaayvldqaekgw
Timeline for d2v08b_: