Lineage for d2v08a_ (2v08 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 905032Protein automated matches [190113] (11 species)
    not a true protein
  7. 905054Species Phormidium laminosum [TaxId:32059] [187369] (2 PDB entries)
  8. 905056Domain d2v08a_: 2v08 A: [168271]
    automated match to d1c6sa_
    complexed with cl, hem, imd, zn

Details for d2v08a_

PDB Entry: 2v08 (more details), 2 Å

PDB Description: structure of wild-type phormidium laminosum cytochrome c6
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d2v08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v08a_ a.3.1.1 (A:) automated matches {Phormidium laminosum [TaxId: 32059]}
dlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittqvtngkagmpaf
kgrltddqiaavaayvldqaekgw

SCOPe Domain Coordinates for d2v08a_:

Click to download the PDB-style file with coordinates for d2v08a_.
(The format of our PDB-style files is described here.)

Timeline for d2v08a_: