SCOPe 2.07: Domain d2uzsa_: 2uzs A:

Lineage for d2uzsa_ (2uzs A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein automated matches [190063] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries)

8. Domain d2uzsa_: 2uzs A: [168263]
   automated match to d1unpa_
   complexed with 4ip; mutant

Details for d2uzsa_

PDB Entry: 2uzs, 2.46 Å

PDB Description: a transforming mutation in the pleckstrin homology domain of akt1 in cancer (akt1-ph_e17k)

PDB Compounds: (A:) RAC-alpha serine/threonine-protein kinase

SCOPe Domain Sequences for d2uzsa_:

Sequence; same for both SEQRES and ATOM records:

>d2uzsa_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsdvaivkegwlhkrgkyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee

Timeline for d2uzsa_:

• d2uzsa_ first appeared in SCOPe 2.01
  
• d2uzsa_ appears in SCOPe 2.06
  
• d2uzsa_ appears in the current release, SCOPe 2.08, called d2uzsa1