SCOPe 2.02: Domain d2uywa_: 2uyw A:

Lineage for d2uywa_ (2uyw A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (4 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [188454] (2 PDB entries)

8. Domain d2uywa_: 2uyw A: [168249]
   automated match to d1rava_
   complexed with btn, fmt

Details for d2uywa_

PDB Entry: 2uyw, 1.7 Å

PDB Description: crystal structure of xenavidin

PDB Compounds: (A:) xenavidin

SCOPe Domain Sequences for d2uywa_:

Sequence; same for both SEQRES and ATOM records:

>d2uywa_ b.61.1.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
qkcnlqgqwrnklgsnliiesvsqngeftgtyftsvsltnstirispltgyqkltekptf
gftvhwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrl

Timeline for d2uywa_:

• d2uywa_ first appeared in SCOPe 2.01
  
• d2uywa_ appears in SCOPe 2.03
  
• d2uywa_ appears in the current release, SCOPe 2.08