SCOPe 2.03: Domain d2uy3a_: 2uy3 A:

Lineage for d2uy3a_ (2uy3 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (46 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188036] (4 PDB entries)

8. Domain d2uy3a_: 2uy3 A: [168221]
   automated match to d1hvqa_
   complexed with h33

Details for d2uy3a_

PDB Entry: 2uy3, 1.9 Å

PDB Description: sccts1_8-chlorotheophylline crystal structure

PDB Compounds: (A:) Endochitinase

SCOPe Domain Sequences for d2uy3a_:

Sequence; same for both SEQRES and ATOM records:

>d2uy3a_ c.1.8.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsdgllh
ctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgaserpfd
savvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdllenad
idfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyisdtsl
lestiadiassssfggialwdasqafsnelngepyveilknllts

Timeline for d2uy3a_:

• d2uy3a_ first appeared in SCOPe 2.01
  
• d2uy3a_ appears in SCOPe 2.02
  
• d2uy3a_ appears in SCOPe 2.04
  
• d2uy3a_ appears in the current release, SCOPe 2.07