Lineage for d2uy3a_ (2uy3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832465Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188036] (5 PDB entries)
  8. 2832470Domain d2uy3a_: 2uy3 A: [168221]
    automated match to d1hvqa_
    complexed with h33

Details for d2uy3a_

PDB Entry: 2uy3 (more details), 1.9 Å

PDB Description: sccts1_8-chlorotheophylline crystal structure
PDB Compounds: (A:) Endochitinase

SCOPe Domain Sequences for d2uy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy3a_ c.1.8.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsdgllh
ctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgaserpfd
savvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdllenad
idfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyisdtsl
lestiadiassssfggialwdasqafsnelngepyveilknllts

SCOPe Domain Coordinates for d2uy3a_:

Click to download the PDB-style file with coordinates for d2uy3a_.
(The format of our PDB-style files is described here.)

Timeline for d2uy3a_: