Lineage for d2uxra_ (2uxr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906297Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries)
  8. 2906302Domain d2uxra_: 2uxr A: [168218]
    automated match to d1lwda_
    complexed with gol, ict, mg

Details for d2uxra_

PDB Entry: 2uxr (more details), 2.3 Å

PDB Description: complex with isocitrate and the protein isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2uxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxra_ c.77.1.0 (A:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk

SCOPe Domain Coordinates for d2uxra_:

Click to download the PDB-style file with coordinates for d2uxra_.
(The format of our PDB-style files is described here.)

Timeline for d2uxra_: