Lineage for d2uxga_ (2uxg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770993Protein automated matches [190545] (9 species)
    not a true protein
  7. 2770994Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries)
  8. 2770999Domain d2uxga_: 2uxg A: [168213]
    automated match to d1bqka_
    complexed with cl, cu, gol

Details for d2uxga_

PDB Entry: 2uxg (more details), 1.99 Å

PDB Description: pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 5.5
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d2uxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxga_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
gn

SCOPe Domain Coordinates for d2uxga_:

Click to download the PDB-style file with coordinates for d2uxga_.
(The format of our PDB-style files is described here.)

Timeline for d2uxga_: