SCOPe 2.02: Domain d2uxac_: 2uxa C:

Lineage for d2uxac_ (2uxa C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (9 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (22 PDB entries)

8. Domain d2uxac_: 2uxa C: [168211]
   automated match to d1lb8a_
   complexed with glu, zn

Details for d2uxac_

PDB Entry: 2uxa, 2.38 Å

PDB Description: crystal structure of the glur2-flip ligand binding domain, r/g unedited.

PDB Compounds: (C:) glutamate receptor subunit glur2-flip

SCOPe Domain Sequences for d2uxac_:

Sequence; same for both SEQRES and ATOM records:

>d2uxac_ c.94.1.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlklse
qgvldklknkwwydkgecg

Timeline for d2uxac_:

• d2uxac_ first appeared in SCOPe 2.01
  
• d2uxac_ appears in SCOPe 2.03
  
• d2uxac_ appears in the current release, SCOPe 2.08