SCOPe 2.04: Domain d2uwfa_: 2uwf A:

Lineage for d2uwfa_ (2uwf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (20 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [188453] (1 PDB entry)

8. Domain d2uwfa_: 2uwf A: [168200]
   automated match to d1hiza_
   complexed with ca, cu

Details for d2uwfa_

PDB Entry: 2uwf, 2.1 Å

PDB Description: crystal structure of family 10 xylanase from bacillus halodurans

PDB Compounds: (A:) alkaline active endoxylanase

SCOPe Domain Sequences for d2uwfa_:

Sequence; same for both SEQRES and ATOM records:

>d2uwfa_ c.1.8.3 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
nqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpre
gewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkankq
lllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetark
yggeeaklyindyntevpskrddlynlvkdlleqgvpidgvghqshiqigwpsiedtras
fekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsat
issvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriidhhhhhh

Timeline for d2uwfa_:

• d2uwfa_ first appeared in SCOPe 2.01
  
• d2uwfa_ appears in SCOPe 2.03
  
• d2uwfa_ appears in SCOPe 2.05
  
• d2uwfa_ appears in the current release, SCOPe 2.08, called d2uwfa1