Lineage for d2uwfa1 (2uwf A:11-360)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (28 species)
not a true protein
Species Bacillus halodurans [TaxId:86665] [188453] (2 PDB entries) 
Domain d2uwfa1: 2uwf A:11-360 [168200]
Other proteins in same PDB: d2uwfa2
automated match to d1hiza_
complexed with ca, cu
Details for d2uwfa1
PDB Entry: 2uwf (more details), 2.1 Å
PDB Description: crystal structure of family 10 xylanase from bacillus halodurans
PDB Compounds: (A:) alkaline active endoxylanaseSCOPe Domain Sequences for d2uwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwfa1 c.1.8.3 (A:11-360) automated matches {Bacillus halodurans [TaxId: 86665]}
nqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpvslqpre
gewnwegadkivefarkhnmelrfhtlvwhsqvpewffidengnrmvdetdpekrkankq
lllermenhiktvverykddvtswdvvnevidddgglresewyqitgtdyikvafetark
yggeeaklyindyntevpskrddlynlvkdlleqgvpidgvghqshiqigwpsiedtras
fekftslgldnqvteldmslygwpptgaytsyddipeelfqaqadrydqlfelyeelsat
issvtfwgiadnhtwlddrareynngvgvdapfvfdhnyrvkpaywriid
SCOPe Domain Coordinates for d2uwfa1:
Click to download the PDB-style file with coordinates for d2uwfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2uwfa1:
- d2uwfa1 first appeared in SCOPe 2.01, called d2uwfa_
- d2uwfa1 appears in SCOPe 2.07
View in 3D
