SCOPe 2.04: Domain d2uwba_: 2uwb A:

Lineage for d2uwba_ (2uwb A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)

8. Domain d2uwba_: 2uwb A: [168196]
   automated match to d1umzb_
   mutant

Details for d2uwba_

PDB Entry: 2uwb, 2 Å

PDB Description: crystal structure of the nasturtium seedling mutant xyloglucanase isoform nxg1-delta-yniig

PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d2uwba_:

Sequence; same for both SEQRES and ATOM records:

>d2uwba_ b.29.1.0 (A:) automated matches {Tropaeolum majus [TaxId: 4020]}
vqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrs
gyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegs
gdremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsv
wdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaa
mewvqknymvynycddptrdhtltpec

Timeline for d2uwba_:

• d2uwba_ first appeared in SCOPe 2.01
  
• d2uwba_ appears in SCOPe 2.03
  
• d2uwba_ appears in SCOPe 2.05
  
• d2uwba_ appears in the current release, SCOPe 2.08