Lineage for d2uwaa_ (2uwa A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 945308Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 945309Protein automated matches [190437] (11 species)
    not a true protein
  7. 945412Species Tropaeolum majus [TaxId:4020] [187334] (3 PDB entries)
  8. 945413Domain d2uwaa_: 2uwa A: [168193]
    automated match to d1umza_
    complexed with gol

Details for d2uwaa_

PDB Entry: 2uwa (more details), 1.8 Å

PDB Description: crystal structure of the nasturtium seedling xyloglucanase isoform nxg1
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d2uwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwaa_ b.29.1.0 (A:) automated matches {Tropaeolum majus [TaxId: 4020]}
ayvqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinry
rsgyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfie
gsgdyniigremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrp
lwvygsvwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygql
sqqqvaamewvqknymvynycddptrdhtltpec

SCOPe Domain Coordinates for d2uwaa_:

Click to download the PDB-style file with coordinates for d2uwaa_.
(The format of our PDB-style files is described here.)

Timeline for d2uwaa_: