Lineage for d2uw1b_ (2uw1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991390Protein automated matches [190435] (11 species)
    not a true protein
  7. 1991462Species Hedera helix [TaxId:4052] [187347] (1 PDB entry)
  8. 1991464Domain d2uw1b_: 2uw1 B: [168186]
    automated match to d1afra_
    complexed with fe, gvm, na

Details for d2uw1b_

PDB Entry: 2uw1 (more details), 1.95 Å

PDB Description: ivy desaturase structure
PDB Compounds: (B:) plastid delta4 multifunctional acyl-acyl carrier protein desaturase

SCOPe Domain Sequences for d2uw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uw1b_ a.25.1.2 (B:) automated matches {Hedera helix [TaxId: 4052]}
mqvthsmppqkleifkslddwarnnvlihlksvekswqpqdylpdpvsdgfeeqvrelre
rakeipddyfvvlvgdmiteealptymsmlnrcdgikdetgaepsawamwtrawtaeenr
hgdllnkylylsgrvdmrkiektiqyligsgmdiksenspylgfiytsfqeratfishan
taklaqhwgdknlahicgsiasdekrhataytkiveklaeidpdttviafadmmrkkitm
pahlmydgsdellfkhftavaqrvgvysaldycdileflvdkwnverltglsdegrkaqe
yvcelgpkirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d2uw1b_:

Click to download the PDB-style file with coordinates for d2uw1b_.
(The format of our PDB-style files is described here.)

Timeline for d2uw1b_: