Lineage for d2rlca_ (2rlc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937469Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)
  8. 1937472Domain d2rlca_: 2rlc A: [168176]
    automated match to d3pvaa_
    complexed with chd, gly, so4

Details for d2rlca_

PDB Entry: 2rlc (more details), 1.8 Å

PDB Description: Crystal Structure of the Conjugated Bile Acid Hydrolase from Clostridium perfringens in Complex with Reaction Products Glycine and Cholate
PDB Compounds: (A:) choloylglycine hydrolase

SCOPe Domain Sequences for d2rlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rlca_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

SCOPe Domain Coordinates for d2rlca_:

Click to download the PDB-style file with coordinates for d2rlca_.
(The format of our PDB-style files is described here.)

Timeline for d2rlca_: