Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188411] (4 PDB entries) |
Domain d2rkbd_: 2rkb D: [168163] automated match to d1pwha_ complexed with k, plp |
PDB Entry: 2rkb (more details), 2.8 Å
SCOPe Domain Sequences for d2rkbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rkbd_ c.79.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qepfhvvtplleswalsqvagmpvflkcenvqpsgsfkirgighfcqemakkgcrhlvcs sggnagiaaayaarklgipativlpestslqvvqrlqgegaevqltgkvwdeanlraqel akrdgwenvppfdhpliwkghaslvqelkavlrtppgalvlavggggllagvvagllevg wqhvpiiamethgahcfnaaitagklvtlpditsvakslgaktvaaralecmqvckihse vvedteavsavqqllddermlvepacgaalaaiysgllrrlqaegclppsltsvvvivcg gnninsrelqalkthlgq
Timeline for d2rkbd_:
View in 3D Domains from other chains: (mouse over for more information) d2rkba_, d2rkbb_, d2rkbc_, d2rkbe_ |