Lineage for d1afrf_ (1afr F:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 279916Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 279917Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 279923Domain d1afrf_: 1afr F: [16810]
    complexed with fe2

Details for d1afrf_

PDB Entry: 1afr (more details), 2.4 Å

PDB Description: stearoyl-acyl carrier protein desaturase from castor seeds

SCOP Domain Sequences for d1afrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afrf_ a.25.1.2 (F:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis)}
mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOP Domain Coordinates for d1afrf_:

Click to download the PDB-style file with coordinates for d1afrf_.
(The format of our PDB-style files is described here.)

Timeline for d1afrf_: