Lineage for d1afre_ (1afr E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729175Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 1729176Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (5 PDB entries)
  8. 1729182Domain d1afre_: 1afr E: [16809]
    complexed with fe2

Details for d1afre_

PDB Entry: 1afr (more details), 2.4 Å

PDB Description: stearoyl-acyl carrier protein desaturase from castor seeds
PDB Compounds: (E:) delta9 stearoyl-acyl carrier protein desaturase

SCOPe Domain Sequences for d1afre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afre_ a.25.1.2 (E:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]}
mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d1afre_:

Click to download the PDB-style file with coordinates for d1afre_.
(The format of our PDB-style files is described here.)

Timeline for d1afre_: