Lineage for d1afre_ (1afr E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2558Protein delta 9-stearoyl-acyl carrier protein desaturase [47261] (1 species)
  7. 2559Species Castor bean (Ricinus communis) [TaxId:3988] [47262] (1 PDB entry)
  8. 2564Domain d1afre_: 1afr E: [16809]

Details for d1afre_

PDB Entry: 1afr (more details), 2.4 Å

PDB Description: stearoyl-acyl carrier protein desaturase from castor seeds

SCOP Domain Sequences for d1afre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afre_ a.25.1.2 (E:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis)}
mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl

SCOP Domain Coordinates for d1afre_:

Click to download the PDB-style file with coordinates for d1afre_.
(The format of our PDB-style files is described here.)

Timeline for d1afre_: