Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) |
Domain d2rfjc_: 2rfj C: [168087] Other proteins in same PDB: d2rfja2, d2rfjb2 automated match to d1jm4b_ |
PDB Entry: 2rfj (more details), 2.05 Å
SCOPe Domain Sequences for d2rfjc_:
Sequence, based on SEQRES records: (download)
>d2rfjc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyya kaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqm
>d2rfjc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqlqylqkvvlkdlwkhsfswpfqrpvklqlpdyytiiknpmdlntikkrlenkyyakas eciedfntmfsncylynkpgddivlmaqaleklfmqklsqm
Timeline for d2rfjc_:
View in 3D Domains from other chains: (mouse over for more information) d2rfja1, d2rfja2, d2rfjb1, d2rfjb2 |