Lineage for d2rf8b_ (2rf8 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1439841Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1439842Protein automated matches [190509] (8 species)
    not a true protein
  7. 1439863Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)
  8. 1439870Domain d2rf8b_: 2rf8 B: [168076]
    automated match to d3pvaa_
    complexed with gol; mutant

Details for d2rf8b_

PDB Entry: 2rf8 (more details), 2.9 Å

PDB Description: Crystal Structure of the mutant C2A conjugated bile acid hydrolase from Clostridium perfringens
PDB Compounds: (B:) choloylglycine hydrolase

SCOPe Domain Sequences for d2rf8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rf8b_ d.153.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
matglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgti
fddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevk
ealknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfd
whvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdami
kndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqin
aidmnkenldgneiktykynktlsinhvn

SCOPe Domain Coordinates for d2rf8b_:

Click to download the PDB-style file with coordinates for d2rf8b_.
(The format of our PDB-style files is described here.)

Timeline for d2rf8b_: