SCOPe 2.08: Domain d2rdlb_: 2rdl B:

Lineage for d2rdlb_ (2rdl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [188254] (1 PDB entry)

8. Domain d2rdlb_: 2rdl B: [168061]
   automated match to d1pjpa_
   complexed with so4

Details for d2rdlb_

PDB Entry: 2rdl, 2.5 Å

PDB Description: Hamster Chymase 2

PDB Compounds: (B:) Chymase 2

SCOPe Domain Sequences for d2rdlb_:

Sequence; same for both SEQRES and ATOM records:

>d2rdlb_ b.47.1.2 (B:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
iiggtecrpharpymayleivtpenhlsacsgflirrnfvmtaahcagrsitvllgahnk
kvkedtwqklevekqfphpkyddrlvlndimllklkekanltlgvgtlpisaksnsippg
rvcravgwgrtnvneppsdtlqevkmrildpqackhfedfhqepqlcvgnpkkirnvykg
dsggpllcagiaqgiasyvlrnakppsvftrishyrpwinkilren

Timeline for d2rdlb_:

• d2rdlb_ first appeared in SCOPe 2.01
  
• d2rdlb_ appears in SCOPe 2.07