SCOP 1.69: Domain d1xsm__: 1xsm -

Lineage for d1xsm__ (1xsm -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)

8. Domain d1xsm__: 1xsm - [16804]

Details for d1xsm__

PDB Entry: 1xsm, 2.3 Å

PDB Description: protein r2 of ribonucleotide reductase from mouse

SCOP Domain Sequences for d1xsm__:

Sequence; same for both SEQRES and ATOM records:

>d1xsm__ a.25.1.2 (-) Ribonucleotide reductase R2 {Mouse (Mus musculus)}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

Timeline for d1xsm__:

• d1xsm__ first appeared (with stable ids) in SCOP 1.55
  
• d1xsm__ appears in SCOP 1.67
  
• d1xsm__ appears in SCOP 1.71
  
• d1xsm__ appears in the current release, SCOPe 2.08, called d1xsma_