SCOPe 2.01: Domain d2raoa_: 2rao A:

Lineage for d2raoa_ (2rao A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (30 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [188592] (1 PDB entry)

8. Domain d2raoa_: 2rao A: [168031]
   automated match to d1aj9a_
   complexed with hem, oxy

Details for d2raoa_

PDB Entry: 2rao, 2 Å

PDB Description: x ray crystal structure of rabbit hemoglobin (oxy form) at 2.0 angstrom resolution

PDB Compounds: (A:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d2raoa_:

Sequence; same for both SEQRES and ATOM records:

>d2raoa_ a.1.1.2 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
kvsealtkavghlddlpgalstlsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
vhasldkflanvstvltskyr

Timeline for d2raoa_:

• d2raoa_ is new in SCOPe 2.01-stable
  
• d2raoa_ appears in SCOPe 2.02
  
• d2raoa_ appears in the current release, SCOPe 2.08