SCOP 1.65: Domain d2r2fb_: 2r2f B:

Lineage for d2r2fb_ (2r2f B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (6 species)

7. Species Salmonella typhimurium [TaxId:90371] [47259] (2 PDB entries)

8. Domain d2r2fb_: 2r2f B: [16803]
   complexed with fe, o

Details for d2r2fb_

PDB Entry: 2r2f, 2.25 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium (oxidized)

SCOP Domain Sequences for d2r2fb_:

Sequence; same for both SEQRES and ATOM records:

>d2r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium}
klsrisainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvft
gltlldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaa
yawseenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltnt
adlirliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealy
aetgwvndvkaflcynankalmnlgyealfppemadvnpailaal

Timeline for d2r2fb_:

• d2r2fb_ first appeared (with stable ids) in SCOP 1.55
  
• d2r2fb_ appears in SCOP 1.63
  
• d2r2fb_ appears in SCOP 1.67
  
• d2r2fb_ appears in the current release, SCOPe 2.08