Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins) automatically mapped to Pfam PF08943 |
Protein automated matches [190931] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [188460] (1 PDB entry) |
Domain d2r6sa_: 2r6s A: [167997] automated match to d1jr7a_ complexed with bcn, fe2, gol, so4 |
PDB Entry: 2r6s (more details), 2.1 Å
SCOPe Domain Sequences for d2r6sa_:
Sequence, based on SEQRES records: (download)
>d2r6sa_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvgkilddl canqlqplllktllnraegallinavgiddvaqademvklatavahligrsnfdamsgqy yarfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhld dwehldhyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfe egvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyf ayathhyqthq
>d2r6sa_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 562]} gqdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvgkilddl canqlqplllktllnraegallinavgiddvaqademvklatavahligrsnfdamsgqy yarfvvknylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehld hyfrhplarrpmrfaapkdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdai etskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayathhyqthq
Timeline for d2r6sa_: