Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
Protein Ribonucleotide reductase R2 [47257] (8 species) |
Species Escherichia coli [TaxId:562] [47258] (23 PDB entries) |
Domain d1rnrb_: 1rnr B: [16799] complexed with fe, hg, oh; mutant |
PDB Entry: 1rnr (more details), 2.5 Å
SCOP Domain Sequences for d1rnrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rnrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
Timeline for d1rnrb_: