SCOPe 2.06: Domain d2r3wb_: 2r3w B:

Lineage for d2r3wb_ (2r3w B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2r3wb_: 2r3w B: [167965]
   automated match to d1bv9a_
   complexed with cl, g3g

Details for d2r3wb_

PDB Entry: 2r3w, 1.92 Å

PDB Description: i84v hiv-1 protease in complex with a amino decorated pyrrolidine- based inhibitor

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2r3wb_:

Sequence; same for both SEQRES and ATOM records:

>d2r3wb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf

Timeline for d2r3wb_:

• d2r3wb_ first appeared in SCOPe 2.01
  
• d2r3wb_ appears in SCOPe 2.05
  
• d2r3wb_ appears in SCOPe 2.07
  
• d2r3wb_ appears in the current release, SCOPe 2.08