Lineage for d1mrrb_ (1mrr B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441523Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 441553Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)
  8. 441591Domain d1mrrb_: 1mrr B: [16795]

Details for d1mrrb_

PDB Entry: 1mrr (more details), 2.5 Å

PDB Description: substitution of manganese for iron in ribonucleotide reductase from escherichia coli. spectroscopic and crystallographic characterization

SCOP Domain Sequences for d1mrrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1mrrb_:

Click to download the PDB-style file with coordinates for d1mrrb_.
(The format of our PDB-style files is described here.)

Timeline for d1mrrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mrra_