Lineage for d1mrra_ (1mrr A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212429Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 212446Species Escherichia coli [TaxId:562] [47258] (10 PDB entries)
  8. 212463Domain d1mrra_: 1mrr A: [16794]

Details for d1mrra_

PDB Entry: 1mrr (more details), 2.5 Å

PDB Description: substitution of manganese for iron in ribonucleotide reductase from escherichia coli. spectroscopic and crystallographic characterization

SCOP Domain Sequences for d1mrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1mrra_:

Click to download the PDB-style file with coordinates for d1mrra_.
(The format of our PDB-style files is described here.)

Timeline for d1mrra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mrrb_