Lineage for d2r1bb_ (2r1b B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050810Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2050836Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 2050845Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)
  8. 2050847Domain d2r1bb_: 2r1b B: [167914]
    automated match to d1c4rg_
    complexed with ca

Details for d2r1bb_

PDB Entry: 2r1b (more details), 1.72 Å

PDB Description: crystal structure of rat neurexin 1beta with a splice insert at ss#4
PDB Compounds: (B:) Neurexin-1-beta

SCOPe Domain Sequences for d2r1bb_:

Sequence, based on SEQRES records: (download)

>d2r1bb_ b.29.1.4 (B:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyl
elhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvieryp
agnndnerlaiarqripyrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqls
glyynglkvlnmaaendaniaivgnvrlvgevp

Sequence, based on observed residues (ATOM records): (download)

>d2r1bb_ b.29.1.4 (B:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyl
elhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvieryp
yrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaend
aniaivgnvrlvgevp

SCOPe Domain Coordinates for d2r1bb_:

Click to download the PDB-style file with coordinates for d2r1bb_.
(The format of our PDB-style files is described here.)

Timeline for d2r1bb_: