SCOPe 2.05: Domain d2r0ja_: 2r0j A:

Lineage for d2r0ja_ (2r0j A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)

8. Domain d2r0ja_: 2r0j A: [167908]
   automated match to d1j7db_

Details for d2r0ja_

PDB Entry: 2r0j, 1.85 Å

PDB Description: crystal structure of the putative ubiquitin conjugating enzyme, pfe1350c, from plasmodium falciparum

PDB Compounds: (A:) Ubiquitin carrier protein

SCOPe Domain Sequences for d2r0ja_:

Sequence; same for both SEQRES and ATOM records:

>d2r0ja_ d.20.1.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
meppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddplds
kvaehfkqdkndaehvarqwnkiyann

Timeline for d2r0ja_:

• d2r0ja_ first appeared in SCOPe 2.01
  
• d2r0ja_ appears in SCOPe 2.04
  
• d2r0ja_ appears in SCOPe 2.06
  
• d2r0ja_ appears in the current release, SCOPe 2.08