SCOPe 2.05: Domain d2r0hd_: 2r0h D:

Lineage for d2r0hd_ (2r0h D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Coprinus cinereus [188451] (2 PDB entries)

8. Domain d2r0hd_: 2r0h D: [167907]
   automated match to d1ul9a_
   complexed with cto

Details for d2r0hd_

PDB Entry: 2r0h, 1.9 Å

PDB Description: fungal lectin cgl3 in complex with chitotriose (chitotetraose)

PDB Compounds: (D:) CGL3 lectin

SCOPe Domain Sequences for d2r0hd_:

Sequence; same for both SEQRES and ATOM records:

>d2r0hd_ b.29.1.0 (D:) automated matches {Coprinus cinereus}
mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanv

Timeline for d2r0hd_:

• d2r0hd_ first appeared in SCOPe 2.01
  
• d2r0hd_ appears in SCOPe 2.04
  
• d2r0hd_ appears in SCOPe 2.06
  
• d2r0hd_ appears in the current release, SCOPe 2.08