Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (11 species) not a true protein |
Species Coprinus cinereus [188451] (2 PDB entries) |
Domain d2r0hc_: 2r0h C: [167906] automated match to d1ul9a_ complexed with cto |
PDB Entry: 2r0h (more details), 1.9 Å
SCOPe Domain Sequences for d2r0hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0hc_ b.29.1.0 (C:) automated matches {Coprinus cinereus} mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy yykkrlegrcekvsykinegqtppfsdvlgvtvlyfan
Timeline for d2r0hc_: