SCOPe 2.05: Domain d2r0fb_: 2r0f B:

Lineage for d2r0fb_ (2r0f B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Coprinus cinereus [188451] (2 PDB entries)

8. Domain d2r0fb_: 2r0f B: [167903]
   automated match to d1ul9a_

Details for d2r0fb_

PDB Entry: 2r0f, 2 Å

PDB Description: Ligand free structure of fungal lectin CGL3

PDB Compounds: (B:) CGL3 lectin

SCOPe Domain Sequences for d2r0fb_:

Sequence; same for both SEQRES and ATOM records:

>d2r0fb_ b.29.1.0 (B:) automated matches {Coprinus cinereus}
mfhilrlestvdlseplkdngiivfqsdkldlepspnlgptgidntnvnlinakgdvllh
igirrrenafvfnsipygesrgpeeriplegtfgdrrdpsitifdhpdryqimidyktvy
yykkrlegrcekvsykinegqtppfsdvlgvtvlyfanvmpra

Timeline for d2r0fb_:

• d2r0fb_ first appeared in SCOPe 2.01
  
• d2r0fb_ appears in SCOPe 2.04
  
• d2r0fb_ appears in SCOPe 2.06
  
• d2r0fb_ appears in the current release, SCOPe 2.08