Lineage for d2qz6a_ (2qz6 A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1055110Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1055111Protein automated matches [190857] (3 species)
    not a true protein
  7. 1055122Species Pseudomonas fluorescens [TaxId:294] [188382] (1 PDB entry)
  8. 1055123Domain d2qz6a_: 2qz6 A: [167890]
    automated match to d1c3ba_

Details for d2qz6a_

PDB Entry: 2qz6 (more details), 2.26 Å

PDB Description: First crystal structure of a psychrophile class C beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2qz6a_:

Sequence, based on SEQRES records: (download)

>d2qz6a_ e.3.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
dirqvvdstveplmqqqdiaglsvaviqngkaqyfnygvankdskqpitentlfeigsvs
ktftatlagyalangklklsdpasqylpalrgdkfdhisllnlgtytagglplqfpeesd
ntgkmisyyqhwkpafapgtqrlysnpsiglfghlaaqslgqpfeklmeqtvlpklglkh
tfisvpetqmslyaqgydkagkpvrvspgaldaeaygiktstsdlihyvevnmhpaklek
plqqaiaathtgyytvdgmtqglgwemypypikvdalvegnstqmamephkvnwltppqa
apldtlvnktgstggfgayvayvpskglgvvilanknypnaervkaahailsam

Sequence, based on observed residues (ATOM records): (download)

>d2qz6a_ e.3.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
dirqvvdstveplmqqqdiaglsvaviqngkaqyfnygvankdskqpitentlfeigsvs
ktftatlagyalangklklsdpasqylpalrgdkfdhisllnlgtytagglplqfptgkm
isyyqhwkpafapgtqrlysnpsiglfghlaaqslgqpfeklmeqtvlpklglkhtfisv
petqmslyaqgydkagkpvrvspgaldaeaygiktstsdlihyvevnmhpaklekplqqa
iaathtgyytvdgmtqglgwemypypikvdalvegnstqmamephkvnwltppqaapldt
lvnktgstggfgayvayvpskglgvvilanknypnaervkaahailsam

SCOPe Domain Coordinates for d2qz6a_:

Click to download the PDB-style file with coordinates for d2qz6a_.
(The format of our PDB-style files is described here.)

Timeline for d2qz6a_: