SCOP 1.69: Domain d1xikb_: 1xik B:

Lineage for d1xikb_ (1xik B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)

8. Domain d1xikb_: 1xik B: [16785]

Details for d1xikb_

PDB Entry: 1xik, 1.7 Å

PDB Description: ribonucleoside-diphosphate reductase 1 beta chain

SCOP Domain Sequences for d1xikb_:

Sequence; same for both SEQRES and ATOM records:

>d1xikb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

Timeline for d1xikb_:

• d1xikb_ first appeared (with stable ids) in SCOP 1.55
  
• d1xikb_ appears in SCOP 1.67
  
• d1xikb_ appears in SCOP 1.71
  
• d1xikb_ appears in the current release, SCOPe 2.08