Lineage for d2quyd_ (2quy D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676575Family d.153.1.3: Penicillin V acylase [56248] (2 proteins)
    automatically mapped to Pfam PF02275
  6. 1676590Protein automated matches [190722] (1 species)
    not a true protein
  7. 1676591Species Bacillus sphaericus [TaxId:1421] [188588] (4 PDB entries)
  8. 1676592Domain d2quyd_: 2quy D: [167830]
    Other proteins in same PDB: d2quya_, d2quyb_, d2quyc_, d2quye_, d2quyf_, d2quyg_, d2quyh_
    automated match to d3pvaa_
    complexed with cl; mutant

Details for d2quyd_

PDB Entry: 2quy (more details), 1.7 Å

PDB Description: truncated mutant asn175ala of penicillin v acylase from bacillus sphaericus
PDB Compounds: (D:) penicillin acylase

SCOPe Domain Sequences for d2quyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quyd_ d.153.1.3 (D:) automated matches {Bacillus sphaericus [TaxId: 1421]}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtaspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnq

SCOPe Domain Coordinates for d2quyd_:

Click to download the PDB-style file with coordinates for d2quyd_.
(The format of our PDB-style files is described here.)

Timeline for d2quyd_: