Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.3: Penicillin V acylase [56248] (2 proteins) automatically mapped to Pfam PF02275 |
Protein automated matches [190722] (1 species) not a true protein |
Species Bacillus sphaericus [TaxId:1421] [188588] (4 PDB entries) |
Domain d2quyd_: 2quy D: [167830] Other proteins in same PDB: d2quya_, d2quyb_, d2quyc_, d2quye_, d2quyf_, d2quyg_, d2quyh_ automated match to d3pvaa_ complexed with cl; mutant |
PDB Entry: 2quy (more details), 1.7 Å
SCOPe Domain Sequences for d2quyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2quyd_ d.153.1.3 (D:) automated matches {Bacillus sphaericus [TaxId: 1421]} csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst ditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvddvi ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtaspgye whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris avslmaenlnsqdlitfewdrkqdikqlnq
Timeline for d2quyd_: