Lineage for d2qu0a_ (2qu0 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903753Species Sheep (Ovis aries) [TaxId:9940] [188522] (1 PDB entry)
  8. 903754Domain d2qu0a_: 2qu0 A: [167802]
    automated match to d1fsxa_
    complexed with hem

Details for d2qu0a_

PDB Entry: 2qu0 (more details), 2.7 Å

PDB Description: crystal structure determination of sheep methemoglobin at 2.7 angstrom resolution
PDB Compounds: (A:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d2qu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qu0a_ a.1.1.2 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d2qu0a_:

Click to download the PDB-style file with coordinates for d2qu0a_.
(The format of our PDB-style files is described here.)

Timeline for d2qu0a_: