Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (30 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [188522] (1 PDB entry) |
Domain d2qu0a_: 2qu0 A: [167802] automated match to d1fsxa_ complexed with hem |
PDB Entry: 2qu0 (more details), 2.7 Å
SCOPe Domain Sequences for d2qu0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qu0a_ a.1.1.2 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa vhasldkflanvstvltskyr
Timeline for d2qu0a_: