Lineage for d2qtmb_ (2qtm B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) 
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) 
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries) 
Domain d2qtmb_: 2qtm B: [167796]
automated match to d1kama_
complexed with co, gol
Details for d2qtmb_
PDB Entry: 2qtm (more details), 2.4 Å
PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase
PDB Compounds: (B:) Nicotinate (Nicotinamide) nucleotide adenylyltransferaseSCOPe Domain Sequences for d2qtmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtmb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes
SCOPe Domain Coordinates for d2qtmb_:
Click to download the PDB-style file with coordinates for d2qtmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qtmb_:
- d2qtmb_ first appeared in SCOPe 2.01
- d2qtmb_ appears in SCOPe 2.07
View in 3D
