![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
![]() | Protein automated matches [190701] (2 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [188587] (2 PDB entries) |
![]() | Domain d2qpza_: 2qpz A: [167756] automated match to d1fqta_ complexed with fes |
PDB Entry: 2qpz (more details), 1.85 Å
SCOPe Domain Sequences for d2qpza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpza_ b.33.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} tvkwieavalsdilegdvlgvtvegkelalyevegeiyatdnlcthgsarmsdgylegre iecplhqgrfdvctgkalcapvtqniktypvkienlrvmidls
Timeline for d2qpza_: